PDB entry 1mh8

View 1mh8 on RCSB PDB site
Description: Crystal Structure of a Phopholipase A2 Monomer with Isoleucine at Second Position
Deposited on 2002-08-19, released 2003-06-10
The last revision prior to the SCOP 1.71 freeze date was dated 2003-06-10, with a file datestamp of 2003-06-10.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1mh8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mh8A (A:)
    niyqfknmiectvparswwdfadygcycggggsgtptddldrccqvhdncynqaqeitgc
    rpkwktytyqctqgtltckgrnnacaattcdcdrlaaicfagapyndtnynidlkarcq