PDB entry 1mh7

View 1mh7 on RCSB PDB site
Description: Crystal Structure of a Calcium-Free Isoform of Phospholipase A2 from Naja naja sagittifera at 2.0 A Resolution
Class: hydrolase
Keywords: phospholipase, enzyme, phospholipids, hydrolase
Deposited on 2002-08-19, released 2003-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mh7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mh7A (A:)
    nlyqfknmiectvparswwdfadygcycggggsgtptddldrccqvhdncynqaqeitgc
    rpkwktytyqctqgtltckgrnnscaattcdcdrlaaicfagapyndtnynidlkarcq