PDB entry 1mh6

View 1mh6 on RCSB PDB site
Description: Solution Structure of the Transposon Tn5-encoding Bleomycin-binding Protein, BLMT
Class: protein binding
Keywords: Antibiotic resistance, Transposable element, PROTEIN BINDING
Deposited on 2002-08-19, released 2003-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bleomycin resistance protein
    Species: Klebsiella pneumoniae [TaxId:573]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mh6a_
  • Chain 'B':
    Compound: bleomycin resistance protein
    Species: Klebsiella pneumoniae [TaxId:573]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mh6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mh6A (A:)
tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqnel
lagis

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mh6B (B:)
tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqnel
lagis