PDB entry 1mh5

View 1mh5 on RCSB PDB site
Description: The Structure Of The Complex Of The Fab Fragment Of The Esterolytic Antibody MS6-164 and A Transition-State Analog
Deposited on 2002-08-19, released 2003-09-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-23, with a file datestamp of 2003-09-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mh5A (A:)
    divmtqaapsvsvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsgtaftlrisrveaedvgvyyclqhleypftfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mh5A (A:)
    divmtqaapsvsvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsgtaftlrisrveaedvgvyyclqhleypftfgagtklelkradaaptv
    sifppasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltltkr
    hnsytceatspivksfn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mh5B (B:)
    qvqlqqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewigniypdsyrtny
    nekfkrkatltvdtssstaymqlssltsddsavyycvrkhysydgvvywgqgtlvtvsaa
    kttapsvyplapvcgdtsgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgptikpcppck
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mh5B (B:)
    vqlqqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewigniypdsyrtnyn
    ekfkrkatltvdtssstaymqlssltsddsavyycvrkhysydgvvywgqgtlvtvsaak
    ttapsvyplapvvtlgclvkgyfpepvtltwvhtfpavlqsdlytlsssvtv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mh5H (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewigniypdsyrtny
    nekfkrkatltvdtssstaymqlssltsddsavyycvrkhysydgvvywgqgtlvtvsaa
    kttapsvyplapvcgdtsgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgptikpcppck
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mh5H (H:)
    vqlqqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewigniypdsyrtnyn
    ekfkrkatltvdtssstaymqlssltsddsavyycvrkhysydgvvywgqgtlvtvsaak
    ttapsvyplapssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvt
    vitcnvahpa
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mh5L (L:)
    divmtqaapsvsvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsgtaftlrisrveaedvgvyyclqhleypftfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mh5L (L:)
    divmtqaapsvsvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsgtaftlrisrveaedvgvyyclqhleypftfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceatspivksfnrn