PDB entry 1mh2

View 1mh2 on RCSB PDB site
Description: Crystal Structure of a Zinc Containing Dimer of Phospholipase A2 from the Venom of Indian Cobra (Naja Naja Sagittifera)
Class: hydrolase
Keywords: phospholipase a2, enzyme, phospholipids, complex, hydrolase
Deposited on 2002-08-19, released 2003-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.196
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mh2a_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mh2b_
  • Heterogens: ZN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mh2A (A:)
    ntyqfqnmiqctvpkrswrdfadygcycgrggsgtpiddldsccqvhdncynsareqggc
    rpkqktytyqckagglscsgannscaattcdcdrlaaicfagapyndnnynidlkarcq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mh2B (B:)
    ntwqfknmisctvpsrswwdfadygcycgrggsgtpsddldrccqthdncyneaekisgc
    nprfrtysyactagtltctgrnnacaasvcdcdrnaaicfagapyndsnynidlqarcn