PDB entry 1mh2
View 1mh2 on RCSB PDB site
Description: Crystal Structure of a Zinc Containing Dimer of Phospholipase A2 from the Venom of Indian Cobra (Naja Naja Sagittifera)
Class: hydrolase
Keywords: phospholipase a2, enzyme, phospholipids, complex, hydrolase
Deposited on
2002-08-19, released
2003-05-20
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.196
AEROSPACI score: 0.28
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: phospholipase a2
Species: Naja sagittifera [TaxId:195058]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1mh2a_ - Chain 'B':
Compound: phospholipase a2
Species: Naja sagittifera [TaxId:195058]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1mh2b_ - Heterogens: ZN, ACY, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1mh2A (A:)
ntyqfqnmiqctvpkrswrdfadygcycgrggsgtpiddldsccqvhdncynsareqggc
rpkqktytyqckagglscsgannscaattcdcdrlaaicfagapyndnnynidlkarcq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1mh2B (B:)
ntwqfknmisctvpsrswwdfadygcycgrggsgtpsddldrccqthdncyneaekisgc
nprfrtysyactagtltctgrnnacaasvcdcdrnaaicfagapyndsnynidlqarcn