PDB entry 1mh1

View 1mh1 on RCSB PDB site
Description: small g-protein
Deposited on 1997-01-21, released 1998-01-21
The last revision prior to the SCOP 1.67 freeze date was dated 1998-01-21, with a file datestamp of 1998-01-21.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.175
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1mh1__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1mh1_ (-)
    gspqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
    agqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkld
    lrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc
    pppvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mh1_ (-)
    gspqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
    agqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkld
    lrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc
    ppp