PDB entry 1mgw

View 1mgw on RCSB PDB site
Description: Crystal structure of RNase Sa3, cytotoxic microbial ribonuclease
Class: hydrolase
Keywords: alpha/beta protein, UB rolls
Deposited on 2002-08-16, released 2003-02-04
The last revision prior to the SCOP 1.75 freeze date was dated 2003-02-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.155
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Guanyl-specific ribonuclease Sa3
  Species: Streptomyces aureofaciens
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30289 (0-98)
  Domains in SCOP 1.75: d1mgwa_
• Heterogens: LI, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mgwA (A:)
  asvkavgrvcysalpsqahdtldlideggpfpysqdgvvfqnregllpahstgyyheytv
  itpgsptrgarriitgqqwqedyytadhyasfrrvdfac