PDB entry 1mgw

View 1mgw on RCSB PDB site
Description: Crystal structure of RNase Sa3, cytotoxic microbial ribonuclease
Deposited on 2002-08-16, released 2003-02-04
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-04, with a file datestamp of 2003-02-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.155
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1mgwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mgwA (A:)
    asvkavgrvcysalpsqahdtldlideggpfpysqdgvvfqnregllpahstgyyheytv
    itpgsptrgarriitgqqwqedyytadhyasfrrvdfac