PDB entry 1mgw

View 1mgw on RCSB PDB site
Description: Crystal structure of RNase Sa3, cytotoxic microbial ribonuclease
Class: hydrolase
Keywords: alpha/beta protein, UB rolls, HYDROLASE
Deposited on 2002-08-16, released 2003-02-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.155
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanyl-specific ribonuclease Sa3
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mgwa_
  • Heterogens: LI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mgwA (A:)
    asvkavgrvcysalpsqahdtldlideggpfpysqdgvvfqnregllpahstgyyheytv
    itpgsptrgarriitgqqwqedyytadhyasfrrvdfac