PDB entry 1mgv

View 1mgv on RCSB PDB site
Description: Crystal Structure of the R391A Mutant of 7,8-Diaminopelargonic Acid Synthase
Class: transferase
Keywords: Aminotransferase, fold type I, subclass II, homodimer, TRANSFERASE
Deposited on 2002-08-16, released 2002-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-diamino-pelargonic acid aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: bioA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12995 (0-End)
      • see remark 999 (13)
      • engineered (390)
    Domains in SCOPe 2.08: d1mgva_
  • Chain 'B':
    Compound: 7,8-diamino-pelargonic acid aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: bioA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12995 (0-End)
      • see remark 999 (13)
      • engineered (390)
    Domains in SCOPe 2.08: d1mgvb_
  • Heterogens: NA, PLP, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mgvA (A:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwiapfgkliylmppyiilpqqlqrltaavnra
    vqdetffcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mgvA (A:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwiapfgkliylmppyiilpqqlqrltaavnra
    vqdetffc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mgvB (B:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwiapfgkliylmppyiilpqqlqrltaavnra
    vqdetffcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mgvB (B:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwiapfgkliylmppyiilpqqlqrltaavnra
    vqdetffc