PDB entry 1mgr

View 1mgr on RCSB PDB site
Description: Crystal structure of RNase Sa3,cytotoxic microbial ribonuclease
Class: hydrolase
Keywords: alpha/beta protein, UB rolls
Deposited on 2002-08-16, released 2003-02-04
The last revision prior to the SCOP 1.73 freeze date was dated 2003-02-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanyl-specific ribonuclease Sa3
    Species: Streptomyces aureofaciens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1mgra_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1mgrA (A:)
asvkavgrvcysalpsqahdtldlideggpfpysqdgvvfqnregllpahstgyyheytv
itpgsptrgarriitgqqwqedyytadhyasfrrvdfac

    Sequence, based on observed residues (ATOM records): (download) 
    >1mgrA (A:)
vkavgrvcysalpsqahdtldlideggpfpysqdgvvfqnregllpahstgyyheytvit
pgsptrgarriitgqqwqedyytadhyasfrrvdfac