PDB entry 1mgr

View 1mgr on RCSB PDB site
Description: Crystal structure of RNase Sa3,cytotoxic microbial ribonuclease
Deposited on 2002-08-16, released 2003-02-04
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-04, with a file datestamp of 2003-02-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1mgra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mgrA (A:)
  vkavgrvcysalpsqahdtldlideggpfpysqdgvvfqnregllpahstgyyheytvit
  pgsptrgarriitgqqwqedyytadhyasfrrvdfac