PDB entry 1mgn

View 1mgn on RCSB PDB site
Description: his64(e7)-> tyr apomyoglobin as a reagent for measuring rates of hemin dissociation
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1993-10-29, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.153
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: metmyoglobin
  Species: Physeter catodon [TaxId:9755]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (1-153)
    • conflict (64)
    • conflict (122)
  Domains in SCOPe 2.07: d1mgna_
• Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mgnA (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkygvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg