PDB entry 1mg8

View 1mg8 on RCSB PDB site
Description: nmr structure of ubiquitin-like domain in murine parkin
Deposited on 2002-08-15, released 2003-04-08
The last revision prior to the SCOP 1.65 freeze date was dated 2003-04-08, with a file datestamp of 2003-04-08.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.65: d1mg8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mg8A (A:)
  mgmivfvrfnssygfpvevdsdtsilqlkevvakrqgvpadqlrvifagkelpnhltvqn
  cdleqqsivhivqrprrr