PDB entry 1mg7

View 1mg7 on RCSB PDB site
Description: Crystal Structure of xol-1
Class: gene regulation
Keywords: alpha-beta
Deposited on 2002-08-14, released 2003-04-22
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.204
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: early switch protein xol-1 2.2k splice form
    Species: Caenorhabditis elegans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1mg7a1, d1mg7a2
  • Chain 'B':
    Compound: early switch protein xol-1 2.2k splice form
    Species: Caenorhabditis elegans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1mg7b1, d1mg7b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mg7A (A:)
    mqveanserrvkilgidrsenspvltymeteddpnfrnsklaaaphtvhmmdsgflainr
    qclvkgkailarepkssnehmiddlpkhahdqhtlsilrdfidqlklhnvyeinfydpld
    ssgklavipmlialwkcmlasetdicdqevlksimnsviakfelqipcknavidatlsgs
    reevhiiaedgslensngttehfnkkhdlvfvktdlhpedftpqmfpsqakakllrdafn
    neededtfpdilvpaymtahsknrvrqedytclevefdsqvaleklmneheqvegfevqq
    ggilvalkkdsffddeliekiaiaiatesrqsvssvsfdllklgpgaslvtlansrrfep
    ecrvvlqievkpvspgetssegisdehhyeeydeddimeeeeapsarqddtydedee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg7A (A:)
    errvkilgidrsenspvltymsklaaaphtvhmmdsgflainrqclvkgkailarepkss
    nehmiddlpkhahdqhtlsilrdfidqlklhnvyeinfydpldssgklavipmlialwkc
    mlasetdicdqevlksimnsviakfelqipcknavidatlsgsreevhiiaesngttehf
    nkkhdlvfvktdlhpedftpqmfpsqakakllrdafnneededtfpdilvpaymtahskn
    rvrqedytclevefdsqvaleklmneheqvegfevqqggilvalkkdsffddeliekiai
    aiatesrqsvssvsfdllklgpgaslvtlansrrfepecrvvlqievkpvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mg7B (B:)
    mqveanserrvkilgidrsenspvltymeteddpnfrnsklaaaphtvhmmdsgflainr
    qclvkgkailarepkssnehmiddlpkhahdqhtlsilrdfidqlklhnvyeinfydpld
    ssgklavipmlialwkcmlasetdicdqevlksimnsviakfelqipcknavidatlsgs
    reevhiiaedgslensngttehfnkkhdlvfvktdlhpedftpqmfpsqakakllrdafn
    neededtfpdilvpaymtahsknrvrqedytclevefdsqvaleklmneheqvegfevqq
    ggilvalkkdsffddeliekiaiaiatesrqsvssvsfdllklgpgaslvtlansrrfep
    ecrvvlqievkpvspgetssegisdehhyeeydeddimeeeeapsarqddtydedee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg7B (B:)
    errvkilgidrsenspvltymsklaaaphtvhmmdsgflainrqclvkgkailarepkss
    nehmiddlpkhahdqhtlsilrdfidqlklhnvyeinfydpldssgklavipmlialwkc
    mlasetdicdqevlksimnsviakfelqipcknavidatlsgsreevhiiaensngtteh
    fnkkhdlvfvktdlhpedftpqmfpsqakakllrdafnneededtfpdilvpaymtahsk
    nrvrqedytclevefdsqvaleklmneheqvegfevqqggilvalkkdsffddeliekia
    iaiatesrqsvssvsfdllklgpgaslvtlansrrfepecrvvlqievkpvs