PDB entry 1mg6

View 1mg6 on RCSB PDB site
Description: the crystal structure of a k49 pla2 from the snake venom of agkistrodon acutus
Deposited on 2002-08-14, released 2002-09-04
The last revision prior to the SCOP 1.71 freeze date was dated 2002-09-04, with a file datestamp of 2002-09-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.197
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1mg6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg6A (A:)
    slfelgkmiwqetgknpvknyglygcncgvggrgepldatdrccfvhkccykkltdcdsk
    kdrysykwknkaivcgknqpcmqemcecdkafaiclrenldtynksfryhlkpsckktse
    qc