PDB entry 1mg5

View 1mg5 on RCSB PDB site
Description: Crystal structure of Drosophila melanogaster alcohol dehydrogenase complexed with NADH and acetate at 1.6 A
Class: oxidoreductase
Keywords: SDR, ADH, Drosophila melanogaster, NADH, acetate, OXIDOREDUCTASE
Deposited on 2002-08-14, released 2003-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.168
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mg5a_
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mg5b_
  • Heterogens: ACT, NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg5A (A:)
    sftltnknvifvaglggigldtskellkrdlknlvildrienpaaiaelkainpkvtvtf
    ypydvtvpiaettkllktifaqlktvdvlingagilddhqiertiavnytglvntttail
    dfwdkrkggpggiicnigsvtgfnaiyqvpvysgtkaavvnftsslaklapitgvtaytv
    npgitrttlvhkfnswldvepqvaekllahptqpslacaenfvkaielnqngaiwkldlg
    tleaiqwtkhwdsgi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg5B (B:)
    sftltnknvifvaglggigldtskellkrdlknlvildrienpaaiaelkainpkvtvtf
    ypydvtvpiaettkllktifaqlktvdvlingagilddhqiertiavnytglvntttail
    dfwdkrkggpggiicnigsvtgfnaiyqvpvysgtkaavvnftsslaklapitgvtaytv
    npgitrttlvhkfnswldvepqvaekllahptqpslacaenfvkaielnqngaiwkldlg
    tleaiqwtkhwdsgi