PDB entry 1mg2

View 1mg2 on RCSB PDB site
Description: mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Class: oxidoreductase
Keywords: electron transfer, methylamine dehydrogenase, cytochrome, blue copper protein, active site mutant, OXIDOREDUCTASE
Deposited on 2002-08-14, released 2002-12-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.173
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylamine dehydrogenase, heavy chain
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29894 (Start-389)
      • engineered (58)
      • see remark 999 (315-316)
    Domains in SCOPe 2.05: d1mg2a_
  • Chain 'B':
    Compound: Methylamine dehydrogenase, light chain
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22619 (Start-130)
      • modified residue (56)
    Domains in SCOPe 2.05: d1mg2b_
  • Chain 'C':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mg2c_
  • Chain 'D':
    Compound: cytochrome c-l
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mg2d_
  • Chain 'E':
    Compound: Methylamine dehydrogenase, heavy chain
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29894 (Start-389)
      • engineered (58)
      • see remark 999 (315-316)
    Domains in SCOPe 2.05: d1mg2e_
  • Chain 'F':
    Compound: Methylamine dehydrogenase, light chain
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22619 (Start-130)
      • modified residue (56)
    Domains in SCOPe 2.05: d1mg2f_
  • Chain 'G':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mg2g_
  • Chain 'H':
    Compound: cytochrome c-l
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mg2h_
  • Chain 'I':
    Compound: Methylamine dehydrogenase, heavy chain
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29894 (Start-389)
      • engineered (58)
      • see remark 999 (315-316)
    Domains in SCOPe 2.05: d1mg2i_
  • Chain 'J':
    Compound: Methylamine dehydrogenase, light chain
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22619 (Start-130)
      • modified residue (56)
    Domains in SCOPe 2.05: d1mg2j_
  • Chain 'K':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mg2k_
  • Chain 'L':
    Compound: cytochrome c-l
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mg2l_
  • Chain 'M':
    Compound: Methylamine dehydrogenase, heavy chain
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29894 (Start-389)
      • engineered (58)
      • see remark 999 (315-316)
    Domains in SCOPe 2.05: d1mg2m_
  • Chain 'N':
    Compound: Methylamine dehydrogenase, light chain
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22619 (Start-130)
      • modified residue (56)
    Domains in SCOPe 2.05: d1mg2n_
  • Chain 'O':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mg2o_
  • Chain 'P':
    Compound: cytochrome c-l
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mg2p_
  • Heterogens: CU, PO4, NA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mg2A (A:)
    aasaqdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaa
    avtqqfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdp
    vtllptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrml
    dvpdcyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqk
    agrlvwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyl
    lvdqrdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktl
    yihdaesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg2A (A:)
    eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaaavtqqfvi
    dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
    ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
    fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
    ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
    rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
    eelrsvnqlghgpqvittadmg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mg2B (B:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg2B (B:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg2C (C:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mg2D (D:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqpkssgedqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg2D (D:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1mg2E (E:)
    aasaqdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaa
    avtqqfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdp
    vtllptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrml
    dvpdcyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqk
    agrlvwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyl
    lvdqrdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktl
    yihdaesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg2E (E:)
    eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaaavtqqfvi
    dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
    ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
    fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
    ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
    rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
    eelrsvnqlghgpqvittadmg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1mg2F (F:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg2F (F:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg2G (G:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mg2H (H:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqpkssgedqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg2H (H:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1mg2I (I:)
    aasaqdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaa
    avtqqfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdp
    vtllptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrml
    dvpdcyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqk
    agrlvwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyl
    lvdqrdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktl
    yihdaesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg2I (I:)
    eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaaavtqqfvi
    dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
    ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
    fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
    ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
    rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
    eelrsvnqlghgpqvittadmg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1mg2J (J:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg2J (J:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg2K (K:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mg2L (L:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqpkssgedqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg2L (L:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqp
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1mg2M (M:)
    aasaqdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaa
    avtqqfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdp
    vtllptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrml
    dvpdcyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqk
    agrlvwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyl
    lvdqrdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktl
    yihdaesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg2M (M:)
    eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaaavtqqfvi
    dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
    ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
    fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
    ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
    rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
    eelrsvnqlghgpqvittadmg
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1mg2N (N:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg2N (N:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mg2O (O:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1mg2P (P:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqpkssgedqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg2P (P:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqp