PDB entry 1mfs

View 1mfs on RCSB PDB site
Description: dynamical behavior of the hiv-1 nucleocapsid protein; nmr, 30 structures
Class: Viral protein
Keywords: nucleocapsid protein, nmr, dynamics, structure, zinc knuckle, hiv-1, zinc binding
Deposited on 1998-04-01, released 1998-06-17
The last revision prior to the SCOP 1.75 freeze date was dated 1998-06-17, with a file datestamp of 2007-06-04.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 nucleocapsid protein
  Species: Human immunodeficiency virus
  Gene: NC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35963 (0-54)
    • conflict (2)
  Domains in SCOP 1.75: d1mfsa_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mfsA (A:)
  mqkgnfrnqrktvkcfncgkeghiakncraprkkgcwkcgkeghqmkdcterqan