PDB entry 1mfq

View 1mfq on RCSB PDB site
Description: Crystal Structure Analysis of a Ternary S-Domain Complex of Human Signal Recognition Particle
Class: signaling protein/RNA
Keywords: RNA-protein complex, A-minor motif, 3-helix junction, SIGNALING PROTEIN/RNA COMPLEX
Deposited on 2002-08-13, released 2002-09-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.229
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7S RNA of human SRP
    Species: Homo sapiens [TaxId:9606]
  • Chain 'B':
    Compound: signal recognition particle 19kDa protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SRP19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1mfqb_
  • Chain 'C':
    Compound: signal recognition particle 54kDa protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SRP54
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1mfqc_
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mfqB (B:)
    mrficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvfleknkmysrew
    nrdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktrtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mfqB (B:)
    rficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvfleknkmysrewn
    rdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktrtq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mfqC (C:)
    mrgshhhhhhkhgqftlrdmyeqfqnimkmgpfsqilgmipgfgtdfmskgneqesmarl
    kklmtimdsmndqeldstdgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvk
    kmggikglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mfqC (C:)
    khgqftlrdmyeqfqnimkmgpfsqilgmipgfneqesmarlkklmtimdsmndqeldst
    dgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvkkmggik