PDB entry 1mfl

View 1mfl on RCSB PDB site
Description: The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
Class: signaling protein
Keywords: pdz domain, phosphorylation, erb-b2, erbin, signaling protein
Deposited on 2002-08-12, released 2003-01-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.169
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Erb-B2 INTERACTING PROTEIN
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96RT1 (0-94)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1mfla1, d1mfla2
  • Chain 'B':
    Compound: PHOSPHORYLATED Erb-B2 carboxyl-terminal fragment.
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MFL (Start-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mflA (A:)
    gsmeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskllqpgdkiiq
    angysfiniehgqavsllktfqntveliivrevss
    

  • Chain 'B':
    No sequence available.