PDB entry 1mff

View 1mff on RCSB PDB site
Description: macrophage migration inhibitory factor y95f mutant
Class: cytokine
Keywords: cytokine, macrophage, inflammatory response, tautomerase
Deposited on 1998-10-19, released 1999-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Mus musculus [TaxId:10090]
    Gene: MIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34884 (0-113)
      • engineered (94)
    Domains in SCOPe 2.07: d1mffa_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Mus musculus [TaxId:10090]
    Gene: MIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34884 (0-113)
      • engineered (94)
    Domains in SCOPe 2.07: d1mffb_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Mus musculus [TaxId:10090]
    Gene: MIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34884 (0-113)
      • engineered (94)
    Domains in SCOPe 2.07: d1mffc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mffA (A:)
    pmfivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtndpcalcs
    lhsigkiggaqnrnyskllcgllsdrlhispdrvfinyydmnaanvgwngstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mffB (B:)
    pmfivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtndpcalcs
    lhsigkiggaqnrnyskllcgllsdrlhispdrvfinyydmnaanvgwngstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mffC (C:)
    pmfivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtndpcalcs
    lhsigkiggaqnrnyskllcgllsdrlhispdrvfinyydmnaanvgwngstfa