PDB entry 1mff
View 1mff on RCSB PDB site
Description: macrophage migration inhibitory factor y95f mutant
Class: cytokine
Keywords: cytokine, macrophage, inflammatory response, tautomerase
Deposited on
1998-10-19, released
1999-07-12
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: macrophage migration inhibitory factor
Species: Mus musculus [TaxId:10090]
Gene: MIF
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1mffa_ - Chain 'B':
Compound: macrophage migration inhibitory factor
Species: Mus musculus [TaxId:10090]
Gene: MIF
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1mffb_ - Chain 'C':
Compound: macrophage migration inhibitory factor
Species: Mus musculus [TaxId:10090]
Gene: MIF
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1mffc_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1mffA (A:)
pmfivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtndpcalcs
lhsigkiggaqnrnyskllcgllsdrlhispdrvfinyydmnaanvgwngstfa
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1mffB (B:)
pmfivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtndpcalcs
lhsigkiggaqnrnyskllcgllsdrlhispdrvfinyydmnaanvgwngstfa
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1mffC (C:)
pmfivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtndpcalcs
lhsigkiggaqnrnyskllcgllsdrlhispdrvfinyydmnaanvgwngstfa