PDB entry 1mfe

View 1mfe on RCSB PDB site
Description:
Deposited on 1993-10-25, released 1994-01-31
The last revision prior to the SCOP 1.65 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1mfeh1, d1mfeh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1mfel1, d1mfel2

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mfeH (H:)
    evqvqqsgtvlarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
    nhkfraktkltavtstitaymelssltnedsavyyctrgghgyygdywgqgasltvssak
    ttppsvyplapgsaaqtdsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mfeH (H:)
    evqvqqsgtvlarpgasvkmsckasgytftnywmhwikqrpgglewigaiypgnsatfyn
    hkfraktkltavtstitaymelssltnedsavyyctrgghgyygdywgqgasltvssakt
    tppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mfeL (L:)
    eavvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
    parfsgsligdkaaltitgaqpedeaiyfcalwcnnhwifgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsradcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mfeL (L:)
    eavvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
    parfsgsligdkaaltitgaqpedeaiyfcalwcnnhwifgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsr