PDB entry 1mfb

View 1mfb on RCSB PDB site
Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-10-25, released 1994-01-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.16
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-lambda se155-4 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAA73089 (0-End)
      • conflict (217)
    Domains in SCOPe 2.01: d1mfbh1, d1mfbh2
  • Chain 'L':
    Compound: igg1-lambda se155-4 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAA39089 (0-End)
      • conflict (27)
      • conflict (30-31)
      • conflict (33)
      • conflict (51)
      • conflict (81)
      • conflict (93-94)
      • conflict (98)
    Domains in SCOPe 2.01: d1mfbl1, d1mfbl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mfbH (H:)
    evqvqqsgtvlarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
    nhkfraktkltavtstitaymelssltnedsavyyctrgghgyygdywgqgasltvssak
    ttppsvyplapgsaaqtdsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mfbH (H:)
    evqvqqsgtvlarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
    nhkfraktkltavtstitaymelssltnedsavyyctrgghgyygdywgqgasltvssak
    ttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mfbL (L:)
    qavvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
    parfsgsligdkaaltitgaqpedeaiyfcalwcnnhwifgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsradcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mfbL (L:)
    qavvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
    parfsgsligdkaaltitgaqpedeaiyfcalwcnnhwifgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsra