PDB entry 1mfa

View 1mfa on RCSB PDB site
Description: structure of a single-chain fv fragment complexed with a carbohydrate antigen at 1.7 angstroms resolution
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-10-25, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.166
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-lambda se155-4 fab (heavy chain)
    Species: MUS MUSCULUS
    Gene:
    Domains in SCOP 1.75: d1mfah1
  • Chain 'L':
    Compound: igg1-lambda se155-4 fab (light chain)
    Species: MUS MUSCULUS
    Gene:
    Domains in SCOP 1.75: d1mfal1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mfaH (H:)
    evqvqqsgtvvarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
    nhkfraktkltavtstttaymelssltsedsavyyctrgghgyygdywgqgasltvssak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mfaH (H:)
    evqvqqsgtvvarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
    nhkfraktkltavtstttaymelssltsedsavyyctrgghgyygdywgqgasltvs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mfaL (L:)
    qivvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
    parfsgsligdkaaltitgaqpedeaiyfcalwsnnhwifgggtkltvlgqpksspsvtl
    fppsseg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mfaL (L:)
    qivvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
    parfsgsligdkaaltitgaqpedeaiyfcalwsnnhwifgggtkltvlgqpg