PDB entry 1mf7

View 1mf7 on RCSB PDB site
Description: integrin alpha m I domain
Class: cell adhesion
Keywords: cell adhesion
Deposited on 2002-08-09, released 2003-05-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.166
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrin alpha m
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11215 (0-191)
      • engineered (190)
      • cloning artifact (192-193)
    Domains in SCOPe 2.05: d1mf7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mf7A (A:)
    cpqedsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfk
    efqnnpnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfg
    dplgyedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealkt
    iqnqlrekifcigs