PDB entry 1mf4

View 1mf4 on RCSB PDB site
Description: Structure-based design of potent and selective inhibitors of phospholipase A2: Crystal structure of the complex formed between phosholipase A2 from Naja Naja sagittifera and a designed peptide inhibitor at 1.9 A resolution
Class: hydrolase/hydrolase inhibitor
Keywords: Naja naja sagittifera, phospholipase A2, designed inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2002-08-09, released 2003-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mf4a_
  • Chain 'B':
    Compound: val-ala-phe-arg-ser
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MF4 (0-4)
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mf4A (A:)
    nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc
    rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn
    

  • Chain 'B':
    No sequence available.