PDB entry 1mf2

View 1mf2 on RCSB PDB site
Description: anti hiv1 protease fab complex
Class: immunoglobulin
Keywords: fab fragment, cross-reactivity, hiv1 protease, enzyme inhibition, immunoglobulin
Deposited on 1996-12-27, released 1997-12-31
The last revision prior to the SCOP 1.75 freeze date was dated 1997-12-31, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.206
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: monoclonal antibody f11.2.32
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAA92992 (3-225)
      • conflict (4)
      • conflict (12)
      • conflict (17)
      • conflict (29-31)
      • conflict (74)
      • conflict (92)
      • insertion (98-99)
      • conflict (100-103)
      • conflict (103)
      • conflict (103)
      • conflict (103)
      • conflict (198-199)
      • conflict (202)
    Domains in SCOP 1.75: d1mf2h1, d1mf2h2
  • Chain 'L':
    Compound: monoclonal antibody f11.2.32
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAA92993 (2-214)
      • conflict (3)
      • conflict (17-18)
      • conflict (26)
      • conflict (33)
      • conflict (35)
      • conflict (37)
      • conflict (39)
      • conflict (53)
      • conflict (57-58)
      • conflict (77)
      • conflict (81)
      • conflict (86)
      • conflict (88)
      • conflict (95-96)
      • conflict (99)
      • conflict (103)
    Domains in SCOP 1.75: d1mf2l1, d1mf2l2
  • Chain 'M':
    Compound: monoclonal antibody f11.2.32
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAA92993 (2-214)
      • conflict (3)
      • conflict (17-18)
      • conflict (26)
      • conflict (33)
      • conflict (35)
      • conflict (37)
      • conflict (39)
      • conflict (53)
      • conflict (57-58)
      • conflict (77)
      • conflict (81)
      • conflict (86)
      • conflict (88)
      • conflict (95-96)
      • conflict (99)
      • conflict (103)
    Domains in SCOP 1.75: d1mf2m1, d1mf2m2
  • Chain 'N':
    Compound: monoclonal antibody f11.2.32
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAA92992 (3-225)
      • conflict (4)
      • conflict (12)
      • conflict (17)
      • conflict (29-31)
      • conflict (74)
      • conflict (92)
      • insertion (98-99)
      • conflict (100-103)
      • conflict (103)
      • conflict (103)
      • conflict (103)
      • conflict (198-199)
      • conflict (202)
    Domains in SCOP 1.75: d1mf2n1, d1mf2n2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mf2H (H:)
    dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mf2H (H:)
    dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
    vtvssakttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mf2L (L:)
    dtvltqspaslavslgqratiscrasesvdyygksfmnwfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtdfslhihpmeeddsamyfcqqskevpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mf2M (M:)
    dtvltqspaslavslgqratiscrasesvdyygksfmnwfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtdfslhihpmeeddsamyfcqqskevpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1mf2N (N:)
    dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mf2N (N:)
    dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
    vtvssakttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd