PDB entry 1mey

View 1mey on RCSB PDB site
Description: crystal structure of a designed zinc finger protein bound to DNA
Class: transferase/DNA
Keywords: zinc finger, protein-DNA interaction, protein design, crystal structure, complex (zinc finger/DNA), transferase/DNA complex
Deposited on 1996-09-27, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*ap*tp*gp*ap*gp*gp*cp*ap*gp*ap*ap*cp*t)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*tp*ap*gp*tp*tp*cp*tp*gp*cp*cp*tp*(c38)p*a)-3')
  • Chain 'C':
    Compound: consensus zinc finger
    Database cross-references and differences (RAF-indexed):
    • PDB 1MEY
    Domains in SCOPe 2.08: d1meyc_
  • Chain 'D':
    Compound: DNA (5'-d(*ap*tp*gp*ap*gp*gp*cp*ap*gp*ap*ap*cp*t)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*tp*ap*gp*tp*tp*cp*tp*gp*cp*cp*tp*(c38)p*a)-3')
  • Chain 'F':
    Compound: consensus zinc finger
    Database cross-references and differences (RAF-indexed):
    • PDB 1MEY (0-End)
    Domains in SCOPe 2.08: d1meyf_
  • Chain 'G':
    Compound: consensus zinc finger
    Database cross-references and differences (RAF-indexed):
    • PDB 1MEY
    Domains in SCOPe 2.08: d1meyg_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1meyC (C:)
    mekpykcpecgksfsqssnlqkhqrthtgekpykcpecgksfsqssdlqkhqrthtgekp
    ykcpecgksfsrsdhlsrhqrthqnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1meyC (C:)
    ekpykcpecgksfsqssnlqkhqrthtgekpykcpecgksfsqssdlqkhqrthtgekpy
    kcpecgksfsrsdhlsrhqrthq
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1meyF (F:)
    mekpykcpecgksfsqssnlqkhqrthtgekpykcpecgksfsqssdlqkhqrthtgekp
    ykcpecgksfsrsdhlsrhqrthqnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1meyF (F:)
    mekpykcpecgksfsqssnlqkhqrthtgekpykcpecgksfsqssdlqkhqrthtgekp
    ykcpecgksfsrsdhlsrhqrthq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1meyG (G:)
    mekpykcpecgksfsqssnlqkhqrthtgekpykcpecgksfsqssdlqkhqrthtgekp
    ykcpecgksfsrsdhlsrhqrthqnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1meyG (G:)
    tgekpykcpecgksfsrsdhlsrhqrth