PDB entry 1mex

View 1mex on RCSB PDB site
Description: Antibody Catalysis of a Bimolecular Cycloaddition Reaction
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2002-08-08, released 2003-09-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.153
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 29G12 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MEX (0-214)
    Domains in SCOPe 2.06: d1mexh1, d1mexh2
  • Chain 'L':
    Compound: Fab 29G12 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MEX (0-212)
    Domains in SCOPe 2.06: d1mexl1, d1mexl2
  • Heterogens: RAC, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mexH (H:)
    qvqlqqsdaelvkpgasvkisckasgytftdhaihwvkqkpeqglewigyispgngdiky
    nekfkgkatltadkssstaymqlnsltsedsavyfckmeyldywgqgttltvssggttpp
    svyplapgsaaqaatnsvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsqsvtcnvahpasstavdkkiapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mexH (H:)
    qvqlqqsdaelvkpgasvkisckasgytftdhaihwvkqkpglewigyispgngdikyne
    kfkgkatltadkssstaymqlnsltsedsavyfckmeyldywgqgttltvssggttppsv
    yplapgsaaqtnsvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvt
    vpsstwpsqsvtcnvahpasstavdkkiapa
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mexL (L:)
    divmtqsqkfmstslgnrvsvtckasqnvgtnvawfqqkpgqspktliysasyrysgvpd
    rftgsgsgtdftltinnvqsedlaeyfcqqynsypytfgggtkleikradaaptvsifpp
    sseqltgggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne