PDB entry 1meu

View 1meu on RCSB PDB site
Description: hiv-1 mutant (v82f, i84v) protease complexed with dmp323
Class: aspartyl protease
Keywords: hydrolase, acid proteinase, aspartyl protease
Deposited on 1997-04-11, released 1998-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03366 (0-98)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.07: d1meua_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03366 (0-98)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.07: d1meub_
• Heterogens: DMP

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1meuA (A:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpfnvigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1meuB (B:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpfnvigrnlltqigctlnf