PDB entry 1meu
View 1meu on RCSB PDB site
Description: hiv-1 mutant (v82f, i84v) protease complexed with dmp323
Class: aspartyl protease
Keywords: hydrolase, acid proteinase, aspartyl protease
Deposited on
1997-04-11, released
1998-04-15
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P03366 (0-98)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.04: d1meua_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P03366 (0-98)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.04: d1meub_ - Heterogens: DMP
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1meuA (A:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpfnvigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1meuB (B:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpfnvigrnlltqigctlnf