PDB entry 1met
View 1met on RCSB PDB site
Description: hiv-1 mutant (v82f) protease complexed with dmp323
Class: aspartyl protease
Keywords: hydrolase, acid proteinase, aspartyl protease
Deposited on
1997-04-11, released
1998-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-11-29, with a file datestamp of
2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1meta_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1metb_ - Heterogens: DMP
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1metA (A:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpfniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1metB (B:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpfniigrnlltqigctlnf