PDB entry 1mer

View 1mer on RCSB PDB site
Description: hiv-1 mutant (i84v) protease complexed with dmp450
Class: aspartyl protease
Keywords: hydrolase, acid proteinase, aspartyl protease
Deposited on 1997-04-11, released 1998-04-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-98)
      • engineered (83)
    Domains in SCOP 1.75: d1mera_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-98)
      • engineered (83)
    Domains in SCOP 1.75: d1merb_
  • Heterogens: DMQ

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1merA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvnvigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1merB (B:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvnvigrnlltqigctlnf