PDB entry 1mer
View 1mer on RCSB PDB site
Description: hiv-1 mutant (i84v) protease complexed with dmp450
Class: aspartyl protease
Keywords: hydrolase, acid proteinase, aspartyl protease
Deposited on
1997-04-11, released
1998-04-15
The last revision prior to the SCOP 1.75 freeze date was dated
2003-04-01, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1mera_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1merb_ - Heterogens: DMQ
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1merA (A:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvnvigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1merB (B:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvnvigrnlltqigctlnf