PDB entry 1meo

View 1meo on RCSB PDB site
Description: human glycinamide ribonucleotide Transformylase at pH 4.2
Class: Transferase
Keywords: purine biosynthesis, Transferase
Deposited on 2002-08-08, released 2002-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.226
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosophoribosylglycinamide formyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GART
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22102 (0-202)
      • expression tag (203-204)
    Domains in SCOPe 2.07: d1meoa1, d1meoa2
  • Heterogens: PO4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1meoA (A:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwvkeehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1meoA (A:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaeagqiilqeavpvkrgdtvatlservklaehkifpaalql
    vasgtvqlgengkicwvkeehh