PDB entry 1mem

View 1mem on RCSB PDB site
Description: Crystal structure of Cathepsin K complexed with a potent vinyl sulfone inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: OSTEOPOROSIS, PROTEASE, DRUG DESIGN, CYSTEINE, OSTEOCLAST, Disease mutation, Disulfide bond, Glycoprotein, Lysosome, Thiol protease, Zymogen, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1997-01-08, released 1998-01-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1mema_
  • Heterogens: 0D6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1memA (A:)
    apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
    dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
    lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
    knswgenwgnkgyilmarnknnacgianlasfpkm