PDB entry 1mek

View 1mek on RCSB PDB site
Description:
Deposited on 1996-04-16, released 1997-04-21
The last revision prior to the SCOP 1.55 freeze date was dated 1997-04-21, with a file datestamp of 1997-04-22.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1mek__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mek_ (-)
    dapeeedhvlvlrksnfaealaahkyllvefyapwcghckalapeyakaagklkaegsei
    rlakvdateesdlaqqygvrgyptikffrngdtaspkeytagreaddivnwlkkrtgpaa