PDB entry 1mek

View 1mek on RCSB PDB site
Description: human protein disulfide isomerase, nmr, 40 structures
Class: electron transport
Keywords: electron transport, redox-active center, isomerase, endoplasmic reticulum
Deposited on 1996-04-16, released 1997-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein disulfide isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1meka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mekA (A:)
    dapeeedhvlvlrksnfaealaahkyllvefyapwcghckalapeyakaagklkaegsei
    rlakvdateesdlaqqygvrgyptikffrngdtaspkeytagreaddivnwlkkrtgpaa