PDB entry 1mej

View 1mej on RCSB PDB site
Description: Human Glycinamide Ribonucleotide Transformylase domain at pH 8.5
Class: Transferase
Keywords: purine biosynthesis, Transferase
Deposited on 2002-08-08, released 2002-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GART
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22102 (13-End)
      • leader sequence (10-12)
    Domains in SCOPe 2.07: d1meja1, d1meja2
  • Chain 'B':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GART
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22102 (13-End)
      • leader sequence (10-12)
    Domains in SCOPe 2.07: d1mejb1, d1mejb2
  • Chain 'C':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GART
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22102 (13-End)
      • leader sequence (10-12)
    Domains in SCOPe 2.07: d1mejc1, d1mejc2
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mejA (A:)
    asmtggqqmgrilvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaera
    giptrvinhklyknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihp
    sllpsfkgsnaheqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlserv
    klaehkifpaalqlvasgtvqlgengkicwvkeeplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mejA (A:)
    rilvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhk
    lyknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsn
    aheqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpa
    alqlvasgtvqlgengkicwv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mejB (B:)
    asmtggqqmgrilvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaera
    giptrvinhklyknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihp
    sllpsfkgsnaheqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlserv
    klaehkifpaalqlvasgtvqlgengkicwvkeeplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mejB (B:)
    rilvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhk
    lyknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsn
    aheqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpa
    alqlvasgtvqlgengkicwv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mejC (C:)
    asmtggqqmgrilvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaera
    giptrvinhklyknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihp
    sllpsfkgsnaheqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlserv
    klaehkifpaalqlvasgtvqlgengkicwvkeeplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mejC (C:)
    rilvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhk
    lyknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsn
    aheqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpa
    alqlvasgtvqlgengkicwv