PDB entry 1meh

View 1meh on RCSB PDB site
Description: Inosine Monophosphate Dehydrogenase (IMPDH) From Tritrichomonas Foetus with IMP and MOA bound
Class: oxidoreductase
Keywords: alpha beta barrel, OXIDOREDUCTASE
Deposited on 2002-08-08, released 2003-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.243
AEROSPACI score: -1.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Tritrichomonas foetus [TaxId:5724]
    Gene: IMPDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50097
      • modified residue (318)
    Domains in SCOPe 2.07: d1meha1
  • Heterogens: K, IMP, MOA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mehA (A:)
    makyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimq
    svsgekmaialareggisfifgsqsiesqaamvhavknfkagfvvsdsnvkpdqtfadvl
    aisqrtthntvavtddgtphgvllglvtqrdypidltqtetkvsdmmtpfsklvtahqdt
    klseankiiwekklnalpiidddqhlryivfrkdydrsqvchnelvdsqkrylvgagint
    rdfrervpalveagadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfry
    ladagadfikigigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdgg
    ivydyhmtlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqryd
    lggkqklsfeegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvss
    vsiveggahdvivkdrindyhpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mehA (A:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkagfvvshnelvdsqkrylvga
    gintrdfrervpalveagadvlcidssdgfsewqkitigwirekygdkvkvgagnivdge
    gfryladagadfikigigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvc
    sdggivydyhmtlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnw
    eegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsi