PDB entry 1mef

View 1mef on RCSB PDB site
Description: cold-shock protein, nmr, 10 structures
Deposited on 1996-02-16, released 1996-07-11
The last revision was dated 1996-07-11, with a file datestamp of 2007-04-25.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1mef_ (-)
    msgkmtgivkwfnadkgfgfitpddgskdvfvhfsaiqndgyksldegqkvsftiesgak
    gpaagnvtsl
    

  • Chain 'p':
    No sequence available.