PDB entry 1mee

View 1mee on RCSB PDB site
Description: the complex between the subtilisin from a mesophilic bacterium and the leech inhibitor eglin-c
Class: complex(serine proteinase-inhibitor)
Keywords: complex(serine proteinase-inhibitor)
Deposited on 1991-04-15, released 1992-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.151
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mesentericopeptidase
    Species: Bacillus pumilus [TaxId:1408]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07518 (0-274)
      • conflict (87-88)
    Domains in SCOPe 2.07: d1meea_
  • Chain 'I':
    Compound: eglin c
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01051 (0-63)
      • conflict (26)
    Domains in SCOPe 2.07: d1meei_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1meeA (A:)
aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd
gsshgthvagtiaalnnsigvlgvapsaslyavkvldstgsgqyswiingiewaisnnmd
vinmslggptgstalktvvdkavssgivvaaaagnegssgststvgypakypstiavgav
nsanqrasfssagseldvmapgvsiqstlpggtygayngtsmatphvagaaalilskhpt
wtnaqvrdrlestatylgssfyygkglinvqaaaq

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1meeI (I:)
lksfpevvgktvdqareyftlhypqynvyflpegspvtldlrynrvrvfynpgtnvvnhv
phvg