PDB entry 1me6

View 1me6 on RCSB PDB site
Description: crystal structure of plasmepsin II, an aspartyl protease from plasmodium falciparum, in complex with a statine-based inhibitor
Class: hydrolase
Keywords: Protein-ligand complex, HYDROLASE
Deposited on 2002-08-08, released 2004-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.214
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasmepsin II
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PF00026
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1me6a_
  • Chain 'B':
    Compound: plasmepsin II
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PF00026
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1me6b_
  • Heterogens: IVS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1me6A (A:)
    ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
    sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
    dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
    pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
    flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
    lgdpfmrkyftvfdydnhsvgialakknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1me6B (B:)
    ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
    sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
    dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
    pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
    flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
    lgdpfmrkyftvfdydnhsvgialakknl