PDB entry 1mdy

View 1mdy on RCSB PDB site
Description: crystal structure of myod bhlh domain bound to dna: perspectives on dna recognition and implications for transcriptional activation
Deposited on 1994-06-09, released 1994-08-31
The last revision prior to the SCOP 1.67 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.253
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1mdya_
  • Chain 'B':
    Domains in SCOP 1.67: d1mdyb_
  • Chain 'C':
    Domains in SCOP 1.67: d1mdyc_
  • Chain 'D':
    Domains in SCOP 1.67: d1mdyd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdyA (A:)
    melkrkttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyie
    glqallrd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdyB (B:)
    ttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyieglqall
    rd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdyC (C:)
    ttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyieglqall
    rd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdyD (D:)
    ttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyieglqall
    rd