PDB entry 1mdv

View 1mdv on RCSB PDB site
Description: key role of phenylalanine 20 in cytochrome c3: structure, stability and function studies
Class: electron transport
Keywords: mutant cytochrome c3, desulfovibrio vulgaris hildenborough, electron transport
Deposited on 1998-09-08, released 1999-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.224
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: DESULFOVIBRIO VULGARIS [TaxId:882]
    Gene: CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00131 (Start-106)
      • conflict (19)
    Domains in SCOPe 2.07: d1mdva_
  • Chain 'B':
    Compound: cytochrome c3
    Species: DESULFOVIBRIO VULGARIS [TaxId:882]
    Gene: CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00131 (Start-106)
      • conflict (19)
    Domains in SCOPe 2.07: d1mdvb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mdvA (A:)
    apkapadglkmeatkqpvvlnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdk
    sakgyyhvmhdkntkfkscvgchvevagadaakkkdltgckkskche
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mdvA (A:)
    dglkmeatkqpvvlnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdksakgyy
    hvmhdkntkfkscvgchvevagadaakkkdltgckkskche
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mdvB (B:)
    apkapadglkmeatkqpvvlnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdk
    sakgyyhvmhdkntkfkscvgchvevagadaakkkdltgckkskche
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mdvB (B:)
    glkmeatkqpvvlnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdksakgyyh
    vmhdkntkfkscvgchvevagadaakkkdltgckkskche