PDB entry 1mdm

View 1mdm on RCSB PDB site
Description: inhibited fragment of ets-1 and paired domain of pax5 bound to DNA
Class: transcription/DNA
Keywords: Transcription factor, ternary complex, X-ray diffraction, autoinhibition, ETS domain, Paired domain, TRANSCRIPTION/DNA COMPLEX
Deposited on 2002-08-07, released 2002-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.259
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: paired box protein pax-5
    Species: Homo sapiens [TaxId:9606]
    Gene: PAX5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mdma1, d1mdma2
  • Chain 'B':
    Compound: c-ets-1 protein
    Species: Mus musculus [TaxId:10090]
    Gene: ETS-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mdmb_
  • Chain 'C':
    Compound: Pax5/Ets Binding Site on the mb-1 promoter
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: Pax5/Ets Binding Site on the mb-1 promoter
    Species: synthetic, synthetic

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mdmA (A:)
    mdleknyptprtsrtghggvnqlggvfvngrplpdvvrqrivelahqgvrpcdisrqlrv
    shgcvskilgryyetgsikpgviggskpkvatpkvvekiaeykrqnptmfaweirdrlla
    ervcdndtvpsvssinriirtkvqqppnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mdmA (A:)
    gvnqlggvfvngrplpdvvrqrivelahqgvrpcdisrqlrvshgcvskilgryyetgsi
    kpgviggskpkvatpkvvekiaeykrqnptmfaweirdrllaervcdndtvpsvssinri
    irtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mdmB (B:)
    vpsydsfdyedypaalpnhkpkgtfkdyvrdradlnkdkpvipaaalagytgsgpiqlwq
    fllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglryyydk
    niihktagkryvyrfvcdlqsllgytpeelhamldvkpdad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mdmB (B:)
    rdradlnkdkpvipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdp
    devarrwgkrknkpkmnyeklsrglryyydkniihktagkryvyrfvcdlqsllgytpee
    lhamldvkp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.