PDB entry 1mdl

View 1mdl on RCSB PDB site
Description: mandelate racemase mutant k166r co-crystallized with (r)-mandelate
Deposited on 1996-03-29, released 1996-10-14
The last revision prior to the SCOP 1.69 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.184
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1mdl_ (-)
    msevlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalk
    slkqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhe
    tplvkllganarpvqaydshsldgvklateravtaaelgfravktrigypaldqdlavvr
    sirqavgddfgimvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqskln
    vpvqmgenwlgpeemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfq
    eisahllaatptahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mdl_ (-)
    evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
    kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
    lvkllganarpvqaydshsldgvklateravtaaelgfravktrigypaldqdlavvrsi
    rqavgddfgimvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvp
    vqmgenwlgpeemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqei
    sahllaatptahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv