PDB entry 1mdk

View 1mdk on RCSB PDB site
Description: high resolution solution nmr structure of mixed disulfide intermediate between human thioredoxin (c35a, c62a, c69a, c73a) mutant and a 13 residue peptide comprising its target site in human nfkb (residues 56-68 of the p50 subunit of nfkb)
Class: complex (electron transport/peptide)
Keywords: complex (electron transport/peptide)
Deposited on 1995-02-27, released 1995-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (1-104)
      • conflict (34)
      • conflict (61)
      • conflict (68)
      • conflict (72-73)
    Domains in SCOPe 2.06: d1mdka_
  • Chain 'B':
    Compound: target site in human nfkb
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdkA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
    daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv
    

  • Chain 'B':
    No sequence available.